PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_21693_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 282aa    MW: 31889.6 Da    PI: 5.6983
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_21693_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.16.3e-1875128356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Neem_21693_f_1  75 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 128
                     456899***********************************************9 PP

2HD-ZIP_I/II131.24.1e-4274166193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekkrrl+ eqvk+LE++Fe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy+ Lkr+y+a+k++ne+L++++++L++e+++
  Neem_21693_f_1  74 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADNEALQAQNQKLHAEIMA 166
                     69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-1955131IPR009057Homeodomain-like
SuperFamilySSF466891.63E-1965132IPR009057Homeodomain-like
PROSITE profilePS5007117.32970130IPR001356Homeobox domain
SMARTSM003891.8E-1773134IPR001356Homeobox domain
CDDcd000866.26E-1675131No hitNo description
PfamPF000462.8E-1575128IPR001356Homeobox domain
PRINTSPR000311.1E-5101110IPR000047Helix-turn-helix motif
PROSITE patternPS000270105128IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5110126IPR000047Helix-turn-helix motif
PfamPF021831.9E-15130170IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MAFFQANFML QTPHEDEHQP PTSLNPILPS CAPQDFHGVA SFLGKRSMSF PGIDVGEEAN  60
GEDDLSDDGS QAGEKKRRLN MEQVKTLEKN FELGNKLEPE RKMQLARALG LQPRQIAIWF  120
QNRRARWKTK QLEKDYDLLK RQYEAVKADN EALQAQNQKL HAEIMALKSR EVTESINLNI  180
KETEGSCSNR SENSSDIKLD ISRTPAIDSP LSTHPTSRTL FPPSSSSMKP TGVAQQLFQN  240
SSSRPDLQNN NMGTKEESLS SMFCGMDDQS GFWPWLEQQH FS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122130RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006438651.10.0hypothetical protein CICLE_v10032279mg
RefseqXP_006438652.10.0hypothetical protein CICLE_v10032279mg
RefseqXP_006483203.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC031e-123ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A067H5N30.0A0A067H5N3_CITSI; Uncharacterized protein
TrEMBLV4TEZ20.0V4TEZ2_9R
STRINGVIT_01s0026g01950.t011e-180(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26332770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-124HD-ZIP family protein